PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g31890.1.p
Common NameBRADI_3g31890, LOC100845104
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 409aa    MW: 43552.4 Da    PI: 7.4079
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g31890.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.58.1e-10257314562
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                       kr +r   NR +A rs +R+  +i+eLe kv+ L++e ++L  +l +l+   + l ++
  Bradi3g31890.1.p 257 KRVKRVLANRQSAARSKERRMRYIAELEHKVQILQTEATTLSAQLTHLQRDTSGLATQ 314
                       999********************************************99887766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-16253317IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.783255318IPR004827Basic-leucine zipper domain
PfamPF001703.9E-9257315IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.2E-11257314No hitNo description
SuperFamilySSF579597.03E-11257308No hitNo description
CDDcd147036.08E-21258307No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MMNTTNEMMH RHVVQAAAVP FAAGGGRGGM APAHGSKQRA GLPPPAPPSS GSGGSHPQLH  60
ADACVVQMQQ QEGQLLPLRK AHRRSRSDVP FGYFPPPSPK TESGSWAGAG GDDLFSAYMS  120
MEGMDSAGLS NNNSDGEYSR GSSVPAAGNG ADSSENESED YGGGGEGQVF LWGGDAGGSG  180
GKKRNAAGET AALAGRHARS LSMDSLMGRL SFSGANGNGE PGKLFSLEFG SGEFTPAEMK  240
RIMADEKLAE MALADPKRVK RVLANRQSAA RSKERRMRYI AELEHKVQIL QTEATTLSAQ  300
LTHLQRDTSG LATQNNELKF RLQAMEQQAQ LRDALNEALT GEVQRLKLSA TTSELGDGGS  360
SSNLAQKMQL RCQNQMLELH KQQQQQIPFY QLEQPEQNGA ASRTHESK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574243.20.0PREDICTED: transcription factor RF2b-like
TrEMBLA0A0Q3IB960.0A0A0Q3IB96_BRADI; Uncharacterized protein
STRINGBRADI3G31890.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.34e-85bZIP family protein